A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10259 |
Swiss-prot Accession number | P09686 (Sequence in FASTA format) |
Description | Glucagon precursor [Contains: Glicentin-related polypeptide (GRPP);Glucagon; Glucagon-like peptide] (Fragment). |
Source organism | Myoxocephalus scorpius (Shorthorn sculpin) (Daddy sculpin) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Scorpaeniformes;Cottoidei; Cottidae; Myoxocephalus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level |
Protein Length | 96 Amino acids |
Molecular weight | 10755 |
References | 1 PubMed abstract 3549298 |
Domain Name | Hormone_2 |
Hormone Name | Glucagon |
Mature Hormone Sequence | HSEGTFSNDYSKYLETRRAQDFVQWLKNS |
Position of mature hormone in Pre-Hormone protein | 29 Residues from position (29-57) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10260 |
Swiss-prot Accession number | P09686 (Sequence in FASTA format) |
Description | Glucagon precursor [Contains: Glicentin-related polypeptide (GRPP);Glucagon; Glucagon-like peptide] (Fragment). |
Source organism | Myoxocephalus scorpius (Shorthorn sculpin) (Daddy sculpin) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Scorpaeniformes;Cottoidei; Cottidae; Myoxocephalus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 96 Amino acids |
Molecular weight | 10755 |
References | 1 PubMed abstract 3549298 |
Domain Name | Hormone_2 |
Hormone Name | Glucagon-like peptide |
Mature Hormone Sequence | HADGTFTSDVSSYLNDQAIKDFVAKLKSGKV |
Position of mature hormone in Pre-Hormone protein | 31 Residues from position (66-96) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10861 |
Swiss-prot Accession number | P07453 (Sequence in FASTA format) |
Description | Insulin [Contains: Insulin B chain; Insulin A chain]. |
Source organism | Myoxocephalus scorpius (Shorthorn sculpin) (Daddy sculpin) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Scorpaeniformes;Cottoidei; Cottidae; Myoxocephalus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver |
Protein Length | 50 Amino acids |
Molecular weight | 5683 |
References | 1 PubMed abstract 3525155 |
Domain Name | Insulin |
Hormone Name | Insulin B chain |
Mature Hormone Sequence | ADPQHLCGSHLVDALYLVCGDRGFFYNPK |
Position of mature hormone in Pre-Hormone protein | 29 Residues from position (1-29) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10862 |
Swiss-prot Accession number | P07453 (Sequence in FASTA format) |
Description | Insulin [Contains: Insulin B chain; Insulin A chain]. |
Source organism | Myoxocephalus scorpius (Shorthorn sculpin) (Daddy sculpin) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Scorpaeniformes;Cottoidei; Cottidae; Myoxocephalus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver |
Protein Length | 50 Amino acids |
Molecular weight | 5683 |
References | 1 PubMed abstract 3525155 |
Domain Name | Insulin |
Hormone Name | Insulin A chain |
Mature Hormone Sequence | GIVEQCCHRPCNIRVLENYCN |
Position of mature hormone in Pre-Hormone protein | 21 Residues from position (30-50) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11133 |
Swiss-prot Accession number | P69132 (Sequence in FASTA format) |
Description | Somatostatin-1 (Somatostatin I). |
Source organism | Myoxocephalus scorpius (Shorthorn sculpin) (Daddy sculpin) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Scorpaeniformes;Cottoidei; Cottidae; Myoxocephalus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatostatin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Somatostatin inhibits the release of somatotropin |
Protein Length | 14 Amino acids |
Molecular weight | 1640 |
References | 1 PubMed abstract 2889597 |
Domain Name | Somatostatin |
Hormone Name | Somatostatin-1 |
Mature Hormone Sequence | AGCKNFFWKTFTSC |
Position of mature hormone in Pre-Hormone protein | 14 Residues from position (1-14) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11137 |
Swiss-prot Accession number | P09876 (Sequence in FASTA format) |
Description | Somatostatin-2 precursor (Somatostatin II) [Contains: [Tyr21,Gly24]-somatostatin-28; [Tyr7,Gly10]-somatostatin-14] (Fragments). |
Source organism | Myoxocephalus scorpius (Shorthorn sculpin) (Daddy sculpin) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Scorpaeniformes;Cottoidei; Cottidae; Myoxocephalus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatostatin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Somatostatin inhibits the release of somatotropin |
Protein Length | 74 Amino acids |
Molecular weight | 8036 |
References | 1 PubMed abstract 2889597 2 PubMed abstract 2883025 |
Domain Name | Somatostatin |
Hormone Name | [Tyr21,Gly24]-somatostatin-28 |
Mature Hormone Sequence | SVDPPNNIPLRERKAGCKNFYWKGFTSC |
Position of mature hormone in Pre-Hormone protein | 28 Residues from position (47-74) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11138 |
Swiss-prot Accession number | P09876 (Sequence in FASTA format) |
Description | Somatostatin-2 precursor (Somatostatin II) [Contains: [Tyr21,Gly24]-somatostatin-28; [Tyr7,Gly10]-somatostatin-14] (Fragments). |
Source organism | Myoxocephalus scorpius (Shorthorn sculpin) (Daddy sculpin) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Scorpaeniformes;Cottoidei; Cottidae; Myoxocephalus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatostatin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Somatostatin inhibits the release of somatotropin |
Protein Length | 74 Amino acids |
Molecular weight | 8036 |
References | 1 PubMed abstract 2889597 2 PubMed abstract 2883025 |
Domain Name | Somatostatin |
Hormone Name | [Tyr7,Gly10]-somatostatin-14 |
Mature Hormone Sequence | AGCKNFYWKGFTSC |
Position of mature hormone in Pre-Hormone protein | 14 Residues from position (61-74) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |